PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P20830_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 610aa    MW: 66363.5 Da    PI: 5.928
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P20830_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS27.73.3e-09306347142
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRla 42 
                            lv+lLl+cAea s++dl +a+++L +l++ +sp gd+mqR++
  GSMUA_Achr6P20830_001 306 LVHLLLACAEATSKDDLVAARRYLHNLNHVVSPFGDSMQRAI 347
                            68**************************************86 PP

2GRAS336.93.6e-103345609100374
                   GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                            +aI ea+e+e++vH+iD+di qG QWpa+lqaLa+Rp+g+p lRiTgvg+     +++++etg+ La++A++l+vpfef++ +++rle
  GSMUA_Achr6P20830_001 345 RAIFEAFESEDCVHVIDLDILQGYQWPAFLQALAARPGGAPALRITGVGH----PADSVRETGRHLAELAHSLRVPFEFHAATVERLE 428
                            79************************************************....89******************************** PP

                   GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                            dl++++L+ + gEalaVn+v +lhr++   ++l      +L ++++  Pk++++veqea+hn++ Fl rfleal+yysa+fdsl+a++
  GSMUA_Achr6P20830_001 429 DLRPSMLHRRVGEALAVNSVNRLHRVP--GAHLG----PLLAMIRDQAPKIFTLVEQEASHNGPYFLGRFLEALHYYSAIFDSLDATF 510
                            **************************9..44444....5************************************************* PP

                   GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                            p++s +r+kvE++ll++ei+n+vaceg+er++rhe+le+Wr+ +e  GF+ v+ls +a++q k ll  ++ dgyr+ e++g+l+lgW+
  GSMUA_Achr6P20830_001 511 PSDSAARAKVEQFLLAPEIRNIVACEGSERVARHERLERWRRVMEGRGFEGVALSANAVNQSKILLGLYPCDGYRLTEDKGCLLLGWQ 598
                            **************************************************************************************** PP

                   GRAS 364 drpLvsvSaWr 374
                            drp++++SaWr
  GSMUA_Achr6P20830_001 599 DRPIIAASAWR 609
                            **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.927225589IPR005202Transcription factor GRAS
PfamPF035141.2E-100345609IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MINNRCGSFG SLKSDNASSS KQGLPSPTTS AEESNVLTAS MTEEKDQSTL KGLKLDADID  60
VEVQSPDRAL LESLFADQRE YMVSSPKREN MVSSPKRVGL SPTHSHHNSF TYVRGMHGSP  120
GLIQPSYYSS NLCKGKSQSP LHKVCNSSSS LYASCSSSTE LLHGESLALP AVDAFYWDYS  180
RDGYEVCAMG AEFSSEALAA PPMASLPSLL DCFVMESRYG NSANDMMAAG VQFSGEDDRY  240
QQVGGGGAVQ HQEHGFLCAV GPNATSSTTT ATNTTKVEAS YHGLVGGSSA VVPTELEQEQ  300
DSGLQLVHLL LACAEATSKD DLVAARRYLH NLNHVVSPFG DSMQRAIFEA FESEDCVHVI  360
DLDILQGYQW PAFLQALAAR PGGAPALRIT GVGHPADSVR ETGRHLAELA HSLRVPFEFH  420
AATVERLEDL RPSMLHRRVG EALAVNSVNR LHRVPGAHLG PLLAMIRDQA PKIFTLVEQE  480
ASHNGPYFLG RFLEALHYYS AIFDSLDATF PSDSAARAKV EQFLLAPEIR NIVACEGSER  540
VARHERLERW RRVMEGRGFE GVALSANAVN QSKILLGLYP CDGYRLTEDK GCLLLGWQDR  600
PIIAASAWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-3834260996375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009405522.10.0PREDICTED: DELLA protein GAI-like
TrEMBLM0T8T10.0M0T8T1_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P20830_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92213141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-72RGA-like 1